SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011126 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011126
Domain Number 1 Region: 260-378,424-472
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.73e-24
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 
Domain Number 2 Region: 448-564
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.97e-20
Family Ypt/Rab-GAP domain of gyp1p 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011126
Sequence length 595
Comment protein Name="PYU1_T011126" Note="Similar to EVI5L: EVI5-like protein (Homo sapiens)" AED:1 QI:0|0|0|0|1|1|6|0|595
Sequence
MSDVSASTTSSFSEDANAMSGRVSSTMPPSAPATSGWGSSAFVVMKDRATIAKNHLTPQI
LSMREKTSKRMEKYQPSIDKVKSSASAAAILGREKMTPALNRVKEGSTQGWSILKTKLAS
AAPVAEKIQTMGLSVVTDMWVGDLSVDVAFVEHPSRANCRFLNEYKASPTSSSSAAVTPS
ETRLSKLRLTRTSSSTSTASSYSTGGDGGSAPGEQCFANRFIVGTIVLFCGDVQVLARMT
CVNRACRAFIASEKRLWRFCVRYGDIPQSIRVSFWEHAASVQAIRKASELDFDTYLHMAL
SKGECTELIMTDVRRTYGRVAPHKHAPNAKGEVVTDTDQELIDQLSEILHALSCRFPDVG
YCQGMDYIAAYVLDNVKKSSEAREQARSSFAKHIDPSSTSDTESDSVPLSPSRSPQSAAT
RAEVESAFWILVCLFENYGLRQMFSPGLHRLQVHCFQAQRLFELGLPELAAHFETEKVVA
EMFTVGWFQTLFLYLNVLPRESLDRVWDIFLFEKNWKIMLRVAVALLQISEPHVIGKPID
EVMQFLNTFAGKSTELLAREELILNKALGVKVTNSILTKLQRQHAKRKKATPERK
Download sequence
Identical sequences K3X1M7
PYU1_T011126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]