SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011170 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011170
Domain Number 1 Region: 218-481
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.79e-55
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.0077
Further Details:      
 
Domain Number 2 Region: 119-162
Classification Level Classification E-value
Superfamily F-box domain 0.00000959
Family F-box domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011170
Sequence length 557
Comment protein Name="PYU1_T011170" Note="Similar to At5g06550: F-box protein At5g06550 (Arabidopsis thaliana)" AED:0.131766032497329 QI:0|-1|0|1|-1|1|1|0|557
Sequence
MTAQESSGASEQDAAHIPQPAPTATERSLTSMVASMTARNDNDCNDVEQQRALKKPKLND
TAPCAASASEPVAITCKRVLTHPYGIKPIGNFYEDMDKGIADCRAPGLGKLAFLSDMQML
SLLNYLPAKDLCVLGECSRFCYVFSSHDELWRTLVLEEMEGAFQVEDTWKDSYVTTKCGG
RRKRTPIPVQGFYSDLLFQSFYCAAAPIENSWIAVENIDRRSANELSLKDFKRDYEIANR
PVILTEAIDKWPAIEKWTDEYLIKVCEGQTFIAGGFDFPMDKYLHHSRTLMDDQPLFIFD
KFFVDKVPSLAEDYDVPKYFQEDFFSLLGEQRPDYRWLIIGPKKSGSTFHIDPNSTNAWN
GVIRGSKKWIMFPPEIVPPGVHPSEDGGDVSTPVSLMEWFVTFYPQIRKLPSHMKPLEGI
CREGEIMFVPHGWWHLVLNLDESIAITQNFACTGNLKGVLRFLQDKPDQVSGLSCEMRPQ
LNGLFHDALKTHQPELFARVTKELDDEYERKHRKSKWELLLQGDQPANDASQDGKTSSSE
TTAAASFSFGFGFQFDE
Download sequence
Identical sequences K3X1S1
PYU1_T011170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]