SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011179 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011179
Domain Number 1 Region: 1812-1995
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.21e-50
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000882
Further Details:      
 
Domain Number 2 Region: 92-184,401-525,1233-1468
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 5.62e-44
Family Calcium ATPase, transmembrane domain M 0.02
Further Details:      
 
Domain Number 3 Region: 2348-2417,2481-2593
Classification Level Classification E-value
Superfamily Nucleotide cyclase 6.12e-40
Family Adenylyl and guanylyl cyclase catalytic domain 0.00022
Further Details:      
 
Domain Number 4 Region: 526-542,882-988,1139-1237
Classification Level Classification E-value
Superfamily HAD-like 2.29e-29
Family Predicted hydrolases Cof 0.044
Further Details:      
 
Domain Number 5 Region: 227-287,359-402
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.00000000000128
Family Calcium ATPase, transduction domain A 0.008
Further Details:      
 
Domain Number 6 Region: 720-783,850-911
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.00000883
Family Metal cation-transporting ATPase, ATP-binding domain N 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011179
Sequence length 2748
Comment protein Name="PYU1_T011179" Note="Similar to ALA3: Phospholipid-transporting ATPase 3 (Arabidopsis thaliana)" AED:0.0227355401964351 QI:0|-1|0|1|-1|1|1|0|2748
Sequence
MPVPSHFCRLETEGLASVVPSASQPPRPSTPRLRGLLARILGWNRVRSVPGQELSDADQL
HAQSSPQIKSRVLFINDVLRTHEYASYIEKKYSTERYHANVVRTSKYTVFNFLPKSLFEQ
FRRIANFYFLIISLLQLCTNLSPTNEYSTIGPLAIVLFATMVKEGMEDRLRHQQDYVVNH
QKAEVLGATSDNQTADQSSSKVTHTPAPPLGSSKGRGNGGSSRSLSFQPVFWKNLRVGHV
IKIHDKEQIPADIVLLFSSHEDSEAMCETSSLDGESNLKVRHCMQWQNICPDSIMDFGTT
INSEIRCELPNKRLYSFDGVLRVSYASEQAKMEAVARREKQHPSLRSRLLSFSQGMLPDV
EEIPINIENVLLRGMKLCNTKWVIGVVVGAGNDTKLVQNMKAIPSKFSRLDHTANRCIFL
IFAVLFGVCLISSIQASLFAAKVEKHPGYAVAFPFVKKVGAANFLEAWVTYLILYNNMVP
ISLYISLEVVKWYQARRIEDDPKMRCADNGHGVTARTSNVNEDLGQIKYIFTDKTGTLTK
NQMLFKVCSIGGIIYDGTNMNLRRLAKATADGFLSNQPVVKPGTPVSLSSNSIPSSGRDG
SSEGRRPTTKQASLSEKDLRPYYHLVNMIENPTRYMGKEQHSLELARPFFRCLLLCHSAS
VAIEENVHVANRGDNQSSTSGSGGYTLSHIGGRNTLNGSLESTDAFPWSGPLSPKYERKY
FGSSPDEVALLNAAIEFNCVYEERDGDLIHIKLFGKSETYRLLALNEFDSTRKCMSVIVQ
QIHSLSDDEDDENDPERLKKRKQRRRRRNQQPTSMPEEKRDSFVDLERDLATEEEDNRDQ
DESYSDATTANDDEILVFSKGADTVMFANAANAQDISKLGLHVHYFAAMALRTLLLGFKT
LSKNEYLIWKSEYDMARKSLSDREHLCLEVAKKIEKSTYLLGATGVEDLLQDGVKECIDQ
LSQAGVNIWMLTGDKDETAISVGQMCGLIGEKSKMIIIKGKSKQDCLDEIANARRKLKRE
GVWVPGVATRNISLVVNGEALEFLLLDVLTAPTAKTTITSERASIPTLDAFGSEDREAGH
IGNTFLINESASTKSGSSLPLQIPGQHDHHPSSAVGRSQRVTSRHGSSRPSVADSSPVIP
SYELFMELATQCTSVVACRLSPMQKAQVVGLMKSAPGSPLTLAVGDGGNDVSMIQEAHVG
IGIYGHEGMQAVRAADFAIATFENLSRLLLVHGRWNHRRVARVILFSFYKNMSLIMTLFI
FSLRNAYSGQTLYESYLMVGWNVLYTVLPIFVLGIADEDIRDSTVLKHPFVYRSTLKRSE
LSIKKLAMWVFNAVMHSLLVFFFTMSTLSGISSSEGHANGLFTDGTAVYGALVITVTLRS
SLAMQRLHRWGVFHYLSLLGGYMAFLIFVASYSRAYSIFTTFDVFRDFSGIGGMLFPQTT
YWILMLFTSVSSVAPDFAIMYLKQMYLPSSNDIIQEIDSGLGEFNSSSKLNYDDFSIANL
RTNKLTEASLSRSEEQTSAGPTPPGRTDLTASLLDGEWSQKFRDFDRPTEHDELSKQLVA
LQRELAQEIGLPDPILNEDDTQSSRALNVQPSVHPLTLEFMGEEHLTLENEYELTFAIRE
RVRVILCLKILALVIPLYAIYEYFWEGESSYVWIRAGFFICDVVYMRIARTKFFVEYYQS
AILVPFCAIGMALTLTISDTGKFAAALYPIVLFVVIRVKFLYALILSIYNFAFYLLADKV
GIKDESSQNLSDLLLFALYMAFVISFGAYSCYSLQITMRRDFLQSRSLLIEQKRSTQILK
NMLPEHVVQRMQKGDSLISEDEKDVTILFCDIADFASFVNRFGPTEVVSLLDRVYSLFDQ
ICQKHGVRKMETVGKTYMACAGLQGKDRGKEAALRAVSMAIDMLSFLDKCRSSNGNGIKL
RIGIHSGRVVSGLVGMKKQQFSLFGDTVNTASRMQSTGITGRCQISQVTYKKLAGHFSFE
ERQIDVKGKGAMTTYMVGEPLSEIARMAVLGQLEHIMKRESVIFSEQNVRKAFETDFLSA
TRNKIVQRAKKRWAKYDPIRLLFGSPLSTQFDGKAGGSSSAEAGMLSEIQWLLLYFKEDE
MEHKYLENTLGDRVEGARTTLFSLALYAVFTCLRDLTLELLQEAYDDDPGDTISALTYVI
MLLIRSIYALIAVFFARRARLEFPDYSELKLRNVLIGLYLIGLVCFTISEALLWRLNYVM
EIDTSPRYVNLCLDTVLAMFVVSNGGSILHRHIVSFNLLALIVVSVTSLTSLQINHQDAA
KFNSNFKTSYPLVLTFLSVITNLVASQNVEFFTRRQIWLKTRTQLETMNADRLLYQMLPA
AVVMRLKEGETVCDQHQQVGILFSDIKGFTSIASQADTAQVVDILASLFCAFDKLTEKHG
VFKMQTIGDAYVIVSGLPYVDMSLGPVIGTTGGVTSGMPPTRSTSSRVLPLATIDQGLAS
TERSGGHSSHARRSTLKHKFQMHIRSHIRDLLAMARDMHKEVRKVQDPNTGERLQMRIGI
HIGNIIGGVIGTTTLRYDMWGPDALTANELESNGVPEKTLVSPIVMEVVKGMPDIRCTFH
KKASFTNVSLMDTYLVDFVEFPDSDNNASNTGSNHTFAPIGSVNGDGDADNSPKSMSSIT
LPDDDTGRTGSSSSMKPTAPVLSSSGIRASLSQRSSNRSINRGLLGKAAPLSAILGSGSL
RNVSGATMPTSALDHKDVHASDSTSRRTASSPSLERTIQNTLHTVEDV
Download sequence
Identical sequences K3X1T0
PYU1_T011179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]