SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011183 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011183
Domain Number 1 Region: 116-196
Classification Level Classification E-value
Superfamily F-box domain 0.000000000959
Family F-box domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011183
Sequence length 337
Comment protein Name="PYU1_T011183" Note="Similar to Fbxo9: F-box only protein 9 (Rattus norvegicus)" AED:1 QI:0|0|0|0|1|1|3|0|337
Sequence
MDSHRHRDADEEALQAALFESVQPDYLAEILEAESQRGEAPRAQLQDTAAVADNGSNGAT
GTDLSDDGDAGAVQSDADADEDLAAQVDHLLQLSDESDVDEEEDANLHHVFLNFAEYLII
DILRYLDEDSIGNALCSCKRLHHVARADELFETLCRRIFPVQCPKVAVAAAADRFALRKF
RTWFDMFYERPRVRYNGFYWLKISYYKKPELNMWTDITPGTILQVIYYRYFSFQRDGTVL
YGMLFKPPHEVTSVLRAMDKGVYVGRYHVERDEVFVSVPTSHNVVEFRLRISKKGRGKNV
KLILAEHYSFSEPDRTGWVNYYDTAEEEFQYYRSWNL
Download sequence
Identical sequences K3X1T4
PYU1_T011183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]