SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011205 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011205
Domain Number 1 Region: 326-453
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.66e-24
Family Chaperone J-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 9-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000785
Family DIX domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011205
Sequence length 457
Comment protein Name="PYU1_T011205" Note="Similar to DNAJC6: Putative tyrosine-protein phosphatase auxilin (Bos taurus)" AED:0.131437768240343 QI:0|-1|0|1|-1|1|1|0|457
Sequence
MDSSGIWAFYYIQGEDGEDRSHPNAFKIPANADVTLADVLRHFPLKDPAQFHFRFRINVA
SKTGGGNTFFWLDITNPSQKIPLVNGRVICKLLRLARLAKVGLIFKRKPVLKWSNDAKPR
NSLSSTDAQGSTKTSVQPLSRQQSGGEAPFHRSSSSPAFEKDRPAKYSDGNGNSSKTSSG
NSSRTNSGSQAKVEQTAPAESFEDFLSGGGQPSSSQSAQKPPVNLMNDSGWNDAPTTSQK
PKSDFLSSMDPLAQVNNASSNRPAASSAPTEQPKFDDDNGQTVGPVTMAEMKKYAASTSD
GSNVYNPKFVDKSTKSDHVRRAMEERERQVQMDVEKAREDLRQREETARNMNVMKENAAL
VLGPKLKAWAEDNGRTKNIRTLLSTMHQVMWEGSKWTEVNMGKLLQPADVKKNYRKAMIV
VHPDKSGGRNAEQLLIAERIFAAVNTAWDEFIKTNPC
Download sequence
Identical sequences K3X1V6
PYU1_T011205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]