SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011228 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011228
Domain Number 1 Region: 182-212
Classification Level Classification E-value
Superfamily WW domain 0.000000163
Family WW domain 0.0026
Further Details:      
 
Domain Number 2 Region: 512-607
Classification Level Classification E-value
Superfamily Cyclin-like 0.0000112
Family Cyclin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011228
Sequence length 723
Comment protein Name="PYU1_T011228" Note="Similar to Ccny: Cyclin-Y (Mus musculus)" AED:0.114180478821363 QI:0|-1|0|1|-1|1|1|0|723
Sequence
MHQASFPATSSASNAKRQHHYAQQQPQFHRYAANNNHHSVTRQHQLHASSDRATTADVLA
RAQAIAQTQAQIQAQVQAYAQTGIYSHRQQPQHQPILYGQSLAQNAGFLSGSNFNNKMRA
ANAGMRPTTAATTSSQITPQQQTLHALHQRTALRTKAQAAATTSKASSTTSSSDNDTNNR
AVEWRVAVDPKSKRPYYYHPITRETTWKKPQELVDKEKREKAQFFVAMENNIRSKLRAGN
WPLNQQEDEDNNTVPYRHSDIGIPSSSRSSTSADSTRSSLSSLGRKQKPRVTMGGLITSK
SAPNTPDYGSQPLKPTDNQDSTDDDDIDDEEDDDELTIAASKPPLLFRTLSSYETPVVME
KKTSGVVGQRLVTIPSPIQERVRLASAMQPRASDLESYAQSINRASEAEDGASATRQPLR
RRSNSTSTIYVRMGTMNAPDQDCTIKCVATVLRAHMVEAAESPIEIDSKFDVFISRRERE
RRALAASLGVGGMYAVTNTNALPSSIPSLKEIAAVIKHVFSRAQMESECIIMSLIYVERL
LKATSGSLQLLGYNWRSILFCSMVMASKVWDDLSMCNADFSKIWPELSLKEINELELAYL
SAVEYNVRVSAVSYAKYYFHLRSMCASMGMLAAFDESAPLNLDGARKMQVLSEEYQERSK
LMPAPRRRSVTITTTSIESSLAAASNQPISKPSPAASLEQLVQMQVRGAGGSSLSTMHRL
SKN
Download sequence
Identical sequences K3X1X9
PYU1_T011228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]