SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011286 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011286
Domain Number 1 Region: 1018-1319
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5e-82
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000274
Further Details:      
 
Domain Number 2 Region: 794-965
Classification Level Classification E-value
Superfamily ARM repeat 2e-42
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00011
Further Details:      
 
Domain Number 3 Region: 165-273
Classification Level Classification E-value
Superfamily PH domain-like 8.99e-20
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 4 Region: 649-730
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000213
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 5 Region: 297-381
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000003
Family Ras-binding domain, RBD 0.025
Further Details:      
 
Domain Number 6 Region: 474-590
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000638
Family PLC-like (P variant) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011286
Sequence length 1328
Comment protein Name="PYU1_T011286" Note="Similar to pikB: Phosphatidylinositol 3-kinase 2 (Dictyostelium discoideum)" AED:0.023674069102963 QI:0|0.5|0|1|1|1|3|0|1328
Sequence
MSYSVNPHQMYSTAPKNGPVSSRNTMSSKSMFMGTPSFSGSSSSEISVDNSLVPSFEAMN
PFAKAGLANGDDKRWQPVPDLIHSKESLYFRRAVGQQLKKAHEEISPAELEVRANTPEYK
VDESDWVAHSTNNQLALITPLKAVARIPANLIISDSDVTSTVESTFISGFLRKKGEKNRS
FKRRYMELNGTVLSYYKKKPEKKSGIPLSAAEKKAYERGSIDLDRVSSLQPMENKSEPFG
IHLVTTARTWVIAAESDQDYQRWLKVLCGVVKYSAVHITYKRMFQLQEVSAQAITDVRMV
IATGDTVGEIVEHIFNCYKQALDAAPLRPYDPSKYLLKITGSRDYLIDRFRVMNEYVHVR
ECLLTKKTIRLTVIHESVIQETVMRSLSMRTDSGNDISSQFAELWDGERSSNLQMTTLGD
DWERPSYERGSVIPSGSIHQPFAIRIHRVLNIPRTTCVSKRTSEEASVQHIPLTSSSVIV
RIELYDGGQLLEGGQIDTTDVRLKAQRNDLIYAEWPDSVWHKFNINVSNITRSMRIQLTV
FGVKKVIGASSNNIDTTEERMLCTGINAFEVDGTLTQGTQYVHMYNNLHTCIQGPVPHVV
IPSQPMIHVEFYKFASPVKFDWSVVDSSNNMGERFERHSIVQLSRAEMLWKEDDETAPRK
IIPLRNCSVMPADDMNEQYTTAPVNKGTRKVRQTWCFKVRPQNSSRDYIMLAETKQEREE
WMLAIHTVSKTEENYDSGSMPDVSVKSPPFLPSEADNNAEEAAGKNILENFAQDMRRDSM
ARSSGNSSSTRGTEGVLADLRKVILLDPLFRLSPYQKAQMWKHREEFVEIPAALPRILSC
VHWDDKFEAEEALSLLSRWSVPEHPAAYIEFLNGEFSNENLRQFAVDQLAKMADTTFSYF
LPQLVQAIKFENHHVSALSLLLIERAIKNPNQIGFDLFWAMKVESHNPQYRERYGTILNA
YLDVCSHKMRAILKLQDKLFAADGMFERICQSVKAKKREGGEEMKRVMREGLSALNEVLP
SSFQLPIDPRVEVGKILVNKCRVMDSAKKPLWLVFENAEEGGDPVTVMFKAGDDVRQDCL
TLQLIRLMDEMWRDEGLDLAMEPYKCVATSPMTGILQIVPNSVTTADVHKRVGVLGAFKD
PSFSEWIRANNPDPKSNKAAVDLFRRSCAGYCVATCVLGIGDRHNDNIMIGSNGRYFHID
FGHFLGHFKYQMGVRRERTPFVFTKEMAHVLGGTESNEFRKFVDTCTKAFLIVRKHMHLL
VSLLLLMVPAGMPELTGRDDINHLVMAMAPELPDELACESFEHAIQFCLNSNFKRIDNTI
HILSHLFS
Download sequence
Identical sequences K3X237
PYU1_T011286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]