SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011329 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T011329
Domain Number - Region: 121-172
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000139
Family Myb/SANT domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011329
Sequence length 566
Comment protein Name="PYU1_T011329" Note="Similar to UPF0526 protein (Mus musculus)" AED:0.0964910180596456 QI:0|0|0|0.8|1|1|5|0|566
Sequence
MPKSSETEFDKINGADVTRQAELVAMEYLKSWKCTQTLDQVMAKSKIKSSSLLASELYTT
DLDNKKKAPREYKSVLEYMVSSLSRTSSESRASDSEGSHSSRSSRRRSSVSSDTSQNGGE
VSWSKEDISKLKKAIKETTCVEDKNDRWREIALLVGNGKSKKHCYIKYKELKEEKKSSSS
SRSSPSSSSRRSSEDKSGKQAKSGEGEPGKDKSLLKEKNNVFWVKEKPVREAASRRSTSD
EVASLQSVLFSDGKKAFSSHWEEQGLFYTDVPNLRYGLVQHEGGPCGVLAVVQAYVLRFL
LEQAPRNWQNPDRAEQSKALASALTFILHQAAGGSRTECLVILNERSTASKAPTKRKFMA
GVVIHASPNEADTRALLMDHLDELTERKGNGLVLFVLSVLLSKGVAKIKSEMDQVEGVQQ
RLQREATTGRHERRRPKAVVLKGVPARAAVGFLSLFEAYEYMVVGSHLKCPKFNIWVVCS
ESHYSVLFTEPTHIETAHLDEVRALDLYYYDGLASQDEVIRLSVDALALEEKLVAKHDDL
IPPLNLVIQTKWPLATINWHDVEPLL
Download sequence
Identical sequences K3X280
PYU1_T011329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]