SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011363 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011363
Domain Number 1 Region: 136-272
Classification Level Classification E-value
Superfamily Fibronectin type III 3.77e-18
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 2 Region: 6-40,82-131
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000202
Family Fibronectin type III 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011363
Sequence length 289
Comment protein Name="PYU1_T011363" Note="Similar to Sdk2: Protein sidekick-2 (Mus musculus)" AED:0.2214915797915 QI:0|0|0|0.5|1|1|2|0|289
Sequence
MVAPIITEVSESFVCMRLQLPQGNGSEITRVSIQSQCTGAVASVTTASFRRLLKPQDQDD
TWESIMSDVGLLRNCDADDSHDTNLQANLAVSLDKEFIAMGLAPGCVYYFRAKAFNQSGW
SPDGEVSDGICTNDSPKVVHKSARSITLVWAKPYSTEHIDAYELHARVSTSTQWTTLGTN
LLGQSLVLQDQLIPSTAYSFRIVPHFALRGGRWGDANKCTCSPLITMDAAPPEPPVDLQV
LDRTAQSVTLAWGMPRCNGHVVKSYRLQYRFLAADSSGMRGENQFLVAS
Download sequence
Identical sequences K3X2B4
PYU1_T011363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]