SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011369 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011369
Domain Number 1 Region: 110-219
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.43e-31
Family Canonical RBD 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011369
Sequence length 322
Comment protein Name="PYU1_T011369" Note="Similar to snrnp70: U1 small nuclear ribonucleoprotein 70 kDa (Xenopus tropicalis)" AED:0.117439553781157 QI:0|0.66|0.25|0.75|1|1|4|0|322
Sequence
MNANAHRKMTPKGQMSGSGMGPAISHLPVHLKALFEPNAPLEFKPKLVKRKMPPYEGIAS
FLDQMETEAPPSRVVSETPKERKERLRAERMARNDAEMQANREKWDPNAEDARKTEDAYK
TLFVGRISYETTEKQLRQEFEQYGPVKKVRLVEDEEGKSRGYGFVEYENESDLKAAYKYA
DGKKIDGRRVVVDVERGRTVRDWLPRKFGGGIGETRKGGADVNVKYSGREAIGEFKVGAI
RDSGPDPNDRYRPRREDGPRDRSRSRDRGDRSRRERKRSRSRSPSRSRSRDRRRDRDRGG
RDRSDRRRSRERKSSRDYRDRR
Download sequence
Identical sequences K3X2C0
PYU1_T011369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]