SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011426 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011426
Domain Number 1 Region: 43-388
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 9.92e-104
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000063
Further Details:      
 
Domain Number 2 Region: 570-730
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.18e-40
Family Myf domain 0.0000594
Further Details:      
 
Domain Number 3 Region: 390-538
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 8.78e-29
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011426
Sequence length 732
Comment protein Name="PYU1_T011426" Note="Similar to metG: Methionyl-tRNA synthetase (Thermotoga maritima)" AED:0.442246475670759 QI:0|-1|0|1|-1|1|1|0|732
Sequence
MAEEITDLKQRITSLEVETEKKSSRIRDLQQQVKKAVDENAKNRERFYLTTAIHYTNGQP
HMGHAYENVTSDIIARYHRVFGRDVYFLTGTDEHGQKIAQTAEGLGMQPIELCNKYAGIF
QQLTKDLNMSNDNFIRTTSDVHKKFAQWLFQRALDNGDVYLGKYEGWYNVREEMFVTETE
AQQTDYKDPATGTPFKKMQEESYFFKMSKYQQRLVQHFHDNPEFLQPEVRRQEILRRLEE
PLQDLSASRTTFSHGIPLPNDPKHVMYVWFDALSNYLSAIGYPDEENSKYWPASVHIIGK
DITWFHCVIWPCILMSTGIPLPKRVFAHGFVNAKDGTKMSKSIGNVVDPYDMINKYGLDS
FRYFIVRSARYGYDMPFSEDDLINIHNSELADTLGNLVHRAVNICKKYANGVVPDAATDA
PFDVYSLLHESEIAYKEYALQNACFAIVHALKETNKYLTEKEPWHMKENEPRLVVVRTVL
EAIYVIAHFLSPLMPTVAEKIFEKLGTAPILLTELSPDYDNLKVGTPVTIGDILFNKILS
DEEAKKLEDAAKAKLAPKPVKAEKTATPLFAGLDIRVGVISKVWNHPDSEKLYCEEIDVG
EDEPKQIGSGLRAFYSLEEMQGRKVLVLLNLKPAKLGGFKSHGMVLCATDDAHKRIEFIE
PPADAQVGERVFVDSESGEPLSAAQLKKQKVWEKCAPELLTNEEGVATYKGQIIKTSAGP
CTAKTLVKAHIS
Download sequence
Identical sequences K3X2H7
PYU1_T011426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]