SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011439 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011439
Domain Number 1 Region: 111-223
Classification Level Classification E-value
Superfamily POZ domain 8.37e-21
Family BTB/POZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 30-97
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000899
Family Ubiquitin-related 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011439
Sequence length 315
Comment protein Name="PYU1_T011439" Note="Similar to bath-40: BTB and MATH domain-containing protein 40 (Caenorhabditis elegans)" AED:0.0521303358223855 QI:0|0.8|0.66|0.83|1|1|6|0|315
Sequence
MNRSVRPENVEFTVKAAEDLVLTGKERSIVRVPANNMYSCLMQKTQRFSSLFRHYSKHHG
LPRESLDFFFTNRLDPEDSPESVHLQKNDIILVRRRVTPVVTSTPTHSDDAYFATMKQLY
LSGDGSDITFEVGPEKEILRAHRLILTARCEIFYAMFRPGAMRESEAGAVRIEDHSPDMV
SKMLEFIYTNRVADIGKLNSNQLVDLLTLSEQYLLLPLKHLCEVAAQDVLSVSNIGRFLC
AAEKFNAAFLKEYCISFFVDHMQEIIDDENFRDEIENCPLIALTILRASVRTIGSSPEPA
AKRRRLNMPFEDPDF
Download sequence
Identical sequences K3X2J0
PYU1_T011439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]