SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011470 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011470
Domain Number 1 Region: 127-231
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 1.22e-30
Family MazG-like 0.00017
Further Details:      
 
Domain Number 2 Region: 20-71
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 0.0000000000167
Family MazG-like 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011470
Sequence length 236
Comment protein Name="PYU1_T011470" Note="Similar to XTP3TPA: XTP3-transactivated gene A protein (Homo sapiens)" AED:0.311661049590756 QI:0|0.4|0.33|0.5|1|1|6|64|236
Sequence
MSALLTAEDQPSFRFEATTTLEAIRQMMAQFADERDWNEASSSYHTPRNLVLALTGELGE
LCELFQWKHDGMLVKVKNALKYPPSAHLQVPKTWTEPSVSPVSQEPQSSFCFEPTTTLEL
VRAKTAHFADERGWNPNLTPRNLLLALTGEVGELCEIFQWKGDHIAVADWPQDEKVHLGE
ELSDVLLYLVQLANKCAVDLPVAVKDKMVKNAKKYPAELVKGSSKKYNEYKQLKRN
Download sequence
Identical sequences K3X2M1
PYU1_T011470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]