SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011484 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011484
Domain Number 1 Region: 650-720
Classification Level Classification E-value
Superfamily F-box domain 0.00000000122
Family F-box domain 0.0044
Further Details:      
 
Weak hits

Sequence:  PYU1_T011484
Domain Number - Region: 841-867
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000119
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011484
Sequence length 878
Comment protein Name="PYU1_T011484" Note="Similar to gtf3a: Transcription factor IIIA (Xenopus laevis)" AED:0.0221843003412969 QI:0|-1|0|1|-1|1|1|0|878
Sequence
MRAAASARSLSAPVDLQLKRTLLRNLNETASIASRRVFQTHLLHSHSSLSAIREHLPELC
VFADSLFQIPNVIDSKESASSANRVQRHATTVRHVFKDPEAQWLARSAVESGVAALMCGQ
LIRCAEERFAAKQDTSAAKLVLLLLCDQLLVSCTGKANGSCEWRDRKPSYHSMRCFSIWD
TLLPFLERMAKRFPHMLERVLNDFTAVQPTTSGWKKRVNCNFAHIVGLWRLMEAIGGSKE
DVQPVAPVVVAVNKLTDEAQGSGAMLSLLTSVVRYMMCSTLMKSEARCNEDQEGEVIESE
LKSAAFYDDLLMEKFFSGLQEFMFYCPRSKRIARAALRDSIVDLVVKSTEDTTQQDEAAT
ARPAAPTVPPRLAVFAAVSCLFVKGLVGEIMSNLLDHLHDETRAHTTSRENGVLYFLVGF
AAHVGLVPMNAVLRLFDCLLDIYTSEFERDTRISIVFCIVYVALNRIDVLHTFRGENETS
DAHEDSQSNSSYIALLTFQGRFCGEVENPDFYALPLEWMELLWKEWFELSNDEIASFVTD
YEAYHDEINEAMEDQEHPASPDLLTKSEECIPFRNLSRLFPRQLKLLDSHYIAPGRIDDA
LLASGVISENQNKRALLDGGMLRSRKKARRAIASVDPEAEERKLNVLMLPEVMERVCSFM
SAKRLCRLAVVCKAFAEISRCDRLWRQLWIGLTSRDLEPVRCRHGVKYVHDWRLMYRKRW
DARRRLRKRLRTLQTTSSQRLQDGDLDSTDFANDFNIDDDELTARLPFAARICTHCDCYE
RLNSQAQMDEHMQRHEKFQCIDRDTCCASFTSATQLNKHQKAFHPMLREKKKAVKVVKER
IPCSHEGCTKTYTSLKRLESHRKTHDPVEVPEPLVAAE
Download sequence
Identical sequences K3X2N5
PYU1_T011484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]