SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011521 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011521
Domain Number 1 Region: 218-334
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 6.15e-39
Family eIF-2-alpha, C-terminal domain 0.0000246
Further Details:      
 
Domain Number 2 Region: 115-214
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 2.35e-24
Family eIF2alpha middle domain-like 0.00018
Further Details:      
 
Domain Number 3 Region: 36-117
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.72e-17
Family Cold shock DNA-binding domain-like 0.0000379
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011521
Sequence length 339
Comment protein Name="PYU1_T011521" Note="Similar to tif211: Eukaryotic translation initiation factor 2 subunit alpha (Schizosaccharomyces pombe)" AED:0.00735294117647056 QI:0|-1|0|1|-1|1|1|0|339
Sequence
MSAADAPAAAANAAAGLEDSNASAEIIQLQCRFYEQKYPEIDELVMVNVRSIAEMGAYVS
LLEYNNIEGMILLSELSRRRIRSINKLIRVGKNEVVMVLRVDKEKGYIDLSKRRVSPEDI
AKCEERYNKAKTVHGVLRQVSQDSGLEIEDLYEKIAWPLYKKFKIENENEDDKKVEYVHC
YDVFKMGITDDSVFEGLDITPEILTSLKAHIRRRLTPQPIKVRADIEVTCFTYEGIEAIR
SALQAAQATSTDEIPVKVKLIAPPMYVMTTSTLDKQKGIQKLQEAIEVVREHITAKKGSM
SVKMDPKVVSVNEEKEFLQMIEKLEIENRQVDGDAAEDV
Download sequence
Identical sequences K3X2S2
PYU1_T011521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]