SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011523 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011523
Domain Number 1 Region: 379-494
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 1.18e-37
Family MazG-like 0.0000687
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011523
Sequence length 523
Comment protein Name="PYU1_T011523" Note="Similar to XTP3TPA: XTP3-transactivated gene A protein (Homo sapiens)" AED:0.0545167110200595 QI:0|1|0.6|1|1|1|5|0|523
Sequence
MDLKPLEMKGGVDALDESDDERHANLADIHPAVSSSASVALGGEGEGHDDGLDGGSSAAL
FDEYYDDWAAFDHAVAVAIDKHHPIRKRSSLTFEVYNRTVSKGRHDRKNIAEFLSKTFKC
THGIKFRARGNGRRLRHKLRDIGCPFHVYASAVEFGATYRVKVRMQDKHNHPIGPDTIKN
MPALHDSDYELGSESEAAPSISGSEMQAAASAAALTTSAEMDLQVQFVQAQAAAQAHAHA
QNQAQAQAHAHAMAQAQAQAHAHAQSQALAQAQAQVLLKAQTQAVEQAHAQVQEMLNAQA
QAQALAQAQAQVQARAQAQAHALLQAAHEHETDILDAAGVHESEALLASAIESSMGDEDD
FAHAQKELHSPARFEETTTLESIRKKLAHFADQRDWNQFHTPRNLLLAMTGEVGELCEIF
QWKNENKPIEEWTPEEKTHLGEELSDVLIYLVRLADKCSVDLPTAVHDKIAKNARKYPAE
LVKGSSKKYNEYKRQRVDHDSGNDGGQHDDGTSNGSNTNESTL
Download sequence
Identical sequences K3X2S4
PYU1_T011523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]