SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011561 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011561
Domain Number 1 Region: 1-244
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 6.28e-97
Family Tubulin, GTPase domain 0.00000000126
Further Details:      
 
Domain Number 2 Region: 246-435
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 2.72e-84
Family Tubulin, C-terminal domain 0.0000000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011561
Sequence length 453
Comment protein Name="PYU1_T011561" Note="Similar to TUBA: Tubulin alpha chain (Chlorella vulgaris)" AED:0.0357873210633947 QI:0|-1|0|1|-1|1|1|0|453
Sequence
MREVISVHLGQGGIQTGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK
HVPRAVLVDLEPSVCDEVRTGTYRQLYHPEQIISGKEDAANNYARGHYTIGKEIVDLVLD
RIRKLADNCTGLQGFLVFNAVGGGTGSGLGALLLERLSVDYGRKSKLGFTIYPSPQVSTA
VVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDICRRSLDIERPTYTNLNRLIAQVISSLTA
SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPAS
MMAKCDPRHGKYMAACLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP
TVVPGGDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVSAETAEGEGEEEEFGEEY
Download sequence
Identical sequences K3X2W2
PYU1_T011561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]