SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011571 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011571
Domain Number 1 Region: 51-192
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.73e-18
Family PLC-like (P variant) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011571
Sequence length 349
Comment protein Name="PYU1_T011571" Note="Similar to rbf-1: Rabphilin-1 (Caenorhabditis elegans)" AED:0.0102564102564102 QI:0|1|0.75|1|1|1|4|287|349
Sequence
VELLPSSAHPRAFSSFKRRPPHGSPPQVDSRQQARTMANAESSPLSASSSSSSGNGTIHV
KVLRARNLPTMDFGKRQDPFVLVQLEGSNPKSWATTDPAFQGGTNPEWTEKLNNELELFY
DASLHEKDAVLTVEVFSDETGDELIGTGQINVAKVAKDQTKTSSEYTVRLKNGVGGNANR
GEVVLQVWFGPPVRKAFRAAQRASKLLDARDSVVSTVWSLACGVLNSKYLRGPREYLKKH
RNLSVGLAAVLGIMSAGIVAVFLAIAVPTAVVATFTLPLWIVPFLVTAFFTAPLWIPILL
LVGLFAAFIATFVFGLGVTSRPVRRHGAMLTSRIKHSEMGKRVVYEKEV
Download sequence
Identical sequences K3X2X2
PYU1_T011571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]