SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011578 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011578
Domain Number 1 Region: 61-86,147-331
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.26e-63
Family Mismatch glycosylase 0.0000377
Further Details:      
 
Domain Number 2 Region: 410-556
Classification Level Classification E-value
Superfamily Nudix 0.000000000168
Family MutY C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011578
Sequence length 617
Comment protein Name="PYU1_T011578" Note="Similar to Mutyh: A/G-specific adenine DNA glycosylase (Mus musculus)" AED:0.0368574524897494 QI:0|1|0.66|1|1|1|6|0|617
Sequence
MASKPQGDDEPDMEDFVAPPCRPRQRIKSESKEDVATSSTPAHSASRHRENAHDFNMKEL
RAVRTNLLTWYDAHRRKLPWRGDPPPYLTTATHTKQTHTKQTAAATKSRLATMDAFVTPK
PEPEAETEHGAAAISIEVASPRKVSPYETWVSEIMLQQTRVDTVVEYFLRWTEKFPTVEA
LANGSEEDVNALWAGLGYYRRARMLHAGAKYVVENFEGELPSTIEQLLTIPGIGPYTAGA
ISSIAFENREPLVDGNVIRVLARLRAVGADPKNKQLIKFSWKVAGELVEECDRPGALNQA
MMELGATMCTVQNPECSRCPVQSSCLAYEESQSSHKGEKTTRFASESLVSENDACTICDA
SRYGEWNESIREVTKYPLKAKKGDSKNEVICVAVISYEDEGAAEAKKKKSTAKKPTKGDG
AVPDNWHFLMARRPEEGLLAGQWEFIHQKVDAGDKIPAFAQRKKLMHPRLSELLGEQTTK
FKQFQEQRRDLGELTHIFSHVKHHMGVEHLHFRSKPTVAVIDTMDASQQQQIRWMNAADM
KQLGITTGVKKILNMVTKAPLGASVVDAVASSSNSSSSTKRSAASKRGAAAKAPSHVADG
ASASTKRFKTLTSFFKK
Download sequence
Identical sequences K3X2X9
PYU1_T011578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]