SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011583 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011583
Domain Number 1 Region: 77-180,290-386,825-1073
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 4.45e-96
Family Calcium ATPase, transmembrane domain M 0.00077
Further Details:      
 
Domain Number 2 Region: 390-410,599-847
Classification Level Classification E-value
Superfamily HAD-like 2.63e-58
Family Meta-cation ATPase, catalytic domain P 0.0000989
Further Details:      
 
Domain Number 3 Region: 398-458,501-661
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 3.49e-44
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0000611
Further Details:      
 
Domain Number 4 Region: 179-288
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.79e-27
Family Calcium ATPase, transduction domain A 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011583
Sequence length 1085
Comment protein Name="PYU1_T011583" Note="Similar to ATP1A1: Sodium/potassium-transporting ATPase subunit alpha-1 (Equus caballus)" AED:0.0395948434622468 QI:0|-1|0|1|-1|1|1|0|1085
Sequence
MPAAAQFPKSRLTISEASPRRTDFVALPPSPASAKQTEVAVPIADEDKNRYWQAYCEVDA
LAHQLQDSGIVSHDPALSQGVSSARVPMIRQECGFNRLSPPERTPDYILFLKQFLDSFMI
LLNIAGLLSLIAYLLDTSVSLNLYLAIVLFLIVVFTCIMTFLQERSTSKVMDSFSNMLPQ
QCTVVRDGSSQLIPAEELLVGDLVWIRNGDKVPADIRILQCNNLKVENSSLTGESELIPL
MTKMQDTSVPALECKNVAFNGSLCYDGSALGVVLSIGDKTVIGRIAKLTSSTAQRETNMQ
REVKSFVRFISILAVTMASVLFTIGMIRMKGDDALNTFVNGFLVIIVANVPQGLPATVTS
LLTITAKRMARHNIFVKRLDCVETMGSLTLIATDKTGTLTKNVMTVTDTWYGGAFHHQPS
IDNLIIEDDENLDYLASDVPKAVLFRGATLCNRAAPEPTDPTKGDEASRVLRTSVSRSSN
RLSYLNTPRQSHVGASYRVRRDFVLKRKYTGNPSDIAMLRFADLLFSAELTREHYPLLFE
IPFNSTNKWQLVIVPSPGASTTRHSMDVLIKGAPEVIIKRCNTYMGLNGEEHEIDQAFHD
EFLNAYELFGSNGRRVIALATRRFIPPSADVVFSTEEGNFPTEDLCFVGMIAIMDPPRDD
VPEAIQKCKDAGVKVFMVTGDHPLTAQAIAREIGLLDESDNVLNLLTPPSGHLPKMDWSV
YDAAVVHGGVIDYLSPYQFNAVLSMKQVVFARTTPQHKLEIVRASQQLGECVGVTGDGVN
DAPALKQADVGVAMGKNGSDVAREAADIILMDDNFSSIVRGIEQGRTIYDNLKKTIGYTL
THLWPEVAPVALNLSFGMPSALTSLQILSVDLATELGPAISLAYEGPENDIMSRPPRDMK
KDKLMSSPLLLYSYMIAGMINVTGCFLAYASVFWRNGISLSDIYLSADTYWQDDAPVFCI
ADGTKCFTETQQGAILAEACGSWYIALVMCQFFHVWMCKTRRVSISEHGLFNNAAMIYGT
LLSVSIAVILTYVPSIQDVMGSASAGYVPWLIALGTGTITWVYREGTKTLARRDERSFVA
HHLTW
Download sequence
Identical sequences K3X2Y4
PYU1_T011583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]