SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011615 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011615
Domain Number 1 Region: 547-685
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000876
Family Trypanosoma sialidase, C-terminal domain 0.094
Further Details:      
 
Domain Number 2 Region: 149-221
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000523
Family SIAH, seven in absentia homolog 0.013
Further Details:      
 
Domain Number 3 Region: 827-887
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000209
Family SIAH, seven in absentia homolog 0.03
Further Details:      
 
Weak hits

Sequence:  PYU1_T011615
Domain Number - Region: 749-807
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0235
Family SIAH, seven in absentia homolog 0.015
Further Details:      
 
Domain Number - Region: 221-244
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0785
Family SIAH, seven in absentia homolog 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011615
Sequence length 913
Comment protein Name="PYU1_T011615" Note="Similar to unc-15: Paramyosin (Caenorhabditis elegans)" AED:0.0235229759299781 QI:0|-1|0|1|-1|1|1|0|913
Sequence
MVQCLRPGCLGRFQALRKQQHDQNECVALRHTRKLLQSKEDGATLVPCDLCHSETLVPKR
FLQRHQLISCARRIVSCHFAEWGCADTFPFDEREQHEVDACVVAKRKQQIATDALLVNEV
ITCDWCKEIVKKRHLLDHQEEECLERERPCPNAENGCPEWVPVGKFDEHLRTVCCVTLER
NALAARAREKNSLIMCHDCGVSIKLRRLDRHLRDECVSRIVDCKNAAHGCKARLRWRDRH
LHEDFMALSRDRSMLQFETGGSSYIAVRSNDSSTSSLTDLPPPWTAEYFLWMVDADKEIL
DLLKSSLQRMETVVLQTRELSQWQQNCESCKKKLKELKHMRSQTNKSQVKNLTGAELSLA
AKELADSFHAAETGVRTSQKAITLAKGWIQIFVTEAKRIFQEQEKHDAYDLDNLKAAIAD
QTAQMLEEKPVLVELLPKDELAMLSDLEVWARHVATPGSKSNSPERQQILAEQTKLLKKR
AELQDLVAGLDAEKEAEDAEDGESERLRRRYERELAKVDGKLALVSENTPTELLERRGRH
IIASSSRNAIALVAGSKSQVTFYRSGLPSSSKAAREVHFDVTLKRNQWHHVALCASKKEL
SVFLDGELKTIKRGVFDLPFATIGARDGKDSGGASFQGFVQEIRYWRECRSAQQLRKHAS
TILHVAKCKQLAAYWTFEEGMGELVDDMSLSLPRVPCFHTKWMLYDTPAIRKRFGIPPTP
SLRDQTCCIINQKLKMLAQRARDRDHEVVRCRQHCDELVPLRRLEQHHRLECPYRMVVCK
EIGCGGVYQFVNEAQHLKETCERHLYREELVRKYREKEEMEVCVLNCGLVFKKRVSETHY
HSECISRFIPCPREDCSETIVAKTLEDHLQKDCRSRSLAVERALVARARERQNEKLYLKQ
TSTKVAQEKKKTQ
Download sequence
Identical sequences K3X316
PYU1_T011615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]