SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011649 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011649
Domain Number 1 Region: 9-272
Classification Level Classification E-value
Superfamily DNase I-like 6.41e-40
Family Sphingomyelin phosphodiesterase-like 0.01
Further Details:      
 
Domain Number 2 Region: 281-419
Classification Level Classification E-value
Superfamily Mannose-binding lectins 5.36e-24
Family Mannose-binding lectins 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011649
Sequence length 422
Comment protein Name="PYU1_T011649" Note="Similar to Rv0888: Uncharacterized protein Rv0888/MT0911 (Mycobacterium tuberculosis)" AED:0.333535967578521 QI:0|-1|0|1|-1|1|1|0|422
Sequence
MLRGLADSTFTVMSCNVAGLPAIISSGNPAANSIELGKRLSRWDIVNMQEDFNYHAQVYS
QNTHPYRTATSGGVPFGSGLNTMSRFPFNNITDIDRVKWTKCNNDEGADCLTPKGFTFLE
IQLDDGVTFDLYNLHTDAGIKDADLVARRANLDQIGAYIAANSKDNAVIVMGDTNTRYTR
TGDNIASFASSLGLTDGWVSKIRNGIPPAAGADALVCDQAAVTNDCEVVDKIMFRGNNHL
KFNLESWSNENVAFLDSAGKPLSDHFPIAAKFSWSLNPSIRLSNAVGGPHGTQFTDVASA
AAGQTVSSITIRGADRVDAVSLTVSAPKTVTFTHGGTGGTASTLTLAKGEYIKSLEAHWG
QKGGRTRIFYLSAVTSTGRSVAAGTKTSESTIVYAPAGFQISGFHGRGGDEVDAIGAIYT
KI
Download sequence
Identical sequences K3X350
PYU1_T011649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]