SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011750 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011750
Domain Number 1 Region: 159-303
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.57e-19
Family Single strand DNA-binding domain, SSB 0.0011
Further Details:      
 
Domain Number 2 Region: 10-152
Classification Level Classification E-value
Superfamily BRCA2 helical domain 1.06e-17
Family BRCA2 helical domain 0.00074
Further Details:      
 
Domain Number 3 Region: 330-358,421-502
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000129
Family Single strand DNA-binding domain, SSB 0.0098
Further Details:      
 
Weak hits

Sequence:  PYU1_T011750
Domain Number - Region: 650-713
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.009
Family Single strand DNA-binding domain, SSB 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011750
Sequence length 870
Comment protein Name="PYU1_T011750" Note="Similar to Brca2: Breast cancer type 2 susceptibility protein homolog (Mus musculus)" AED:0.191934315526879 QI:0|0|0|0.66|0|0|3|0|870
Sequence
MTLRYREEMRISFKRLISMHSSIPLTQVDRGKASTHREVLELINAVTALDVVFACDVKDQ
RDCEMPPVCLRGCIDTASDLAIYQGAQEIYDEMCSKKYVSESIGASFAWFLNHYRWIVWK
LASMELSFPYFLFGKYLTKHQVMQQILHRYHKDLCAVRRSILKKVLHRDASPASCMTLCI
AAVLPFKPDQVEHVDMTPPKFWNLGLVLTDGWYSVYAVADFELSRALWKLHAKKCAVGSK
IVCWNAALQNSTDGVDPLQCAIAVDSWKHPLLAKDDLTQWPYLKLHYNSTRRAEFATPLG
LERPIGERDNPGQSMSKERTRLGFALLKSVPMRTLEVSGGMVRSVRIFIARISPVLHLQP
KEFTIGPRILCEEHMQLYYEVRGEVARMNRANEDQEVGNKDQSGSSYDVIEQLDAPFPIP
FVKLDVICTQELITSEQKRTAPCYGILTLWRPPEDLIAGHLCEGKEYYASNLTVNWKIDG
GLFQGVFLRLSSTKGSRFELGEGEDGEEIELRSNRLSALFGNIGSRSCSSIADTIERHRV
AVADGAASNERKMTVDVCVYVLQAADTETLGDIVAKSSSSFSIPSVLENSNIKPEQKSFV
EHVFVTDTSSRIMSIRVSGTVVSLNTAATPSGRQKASRPSSSSFRFRRGNRNIWKEGAVV
CISGLEISHFDEQLDVLDCNLVESSRVTTLPSKKSHFYESFQSLKSQIGDRSKESESDLM
KEVRRLKKYVHRHILQMDFIPTQEAHEEDIEADHLTQDFEAQITSPLKELRTVYLTRKMT
SLLWELLHSVKELPRMAAKVNQGQLTDAELVDNIMHWHDTMGEQELAPRPMFHMEVRRVA
NERLLNSCQDWERYKLKYTVTFQNQNVWRR
Download sequence
Identical sequences K3X3F1
PYU1_T011750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]