SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011774 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011774
Domain Number 1 Region: 4-141
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.57e-40
Family RNA polymerase subunit RBP8 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011774
Sequence length 142
Comment protein Name="PYU1_T011774" Note="Similar to polr2h: DNA-directed RNA polymerases I, II, and III subunit rpabc3 (Dictyostelium discoideum)" AED:0.0941803294744471 QI:0|0.5|0|0.66|1|1|3|0|142
Sequence
MASELFEDIFEVRQVNPDGKKFDKVTRVVCKGVSYELELTLDINSEVYRLRQNEKFTFAL
VSTLDLEGKPDDGTYNQSGKPTLLDRYDYGMYGKVFQYDHEGGNVVAIYASFGGLLMCLR
GEQRHLHMIHNDTRIYCLLRKQ
Download sequence
Identical sequences K3X3H5
PYU1_T011774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]