SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011780 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011780
Domain Number 1 Region: 267-377
Classification Level Classification E-value
Superfamily HisI-like 2.75e-33
Family HisI-like 0.00031
Further Details:      
 
Domain Number 2 Region: 368-450
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 0.000000000000748
Family MazG-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011780
Sequence length 477
Comment protein Name="PYU1_T011780" Note="Similar to his7: Histidine biosynthesis bifunctional protein his7 (Schizosaccharomyces pombe)" AED:0.226724715338245 QI:0|1|0.5|1|1|1|2|59|477
Sequence
MLVPELELHAAALQNEAKKAPEAQWEQVRKISIINCLYAHLSVEKLVALAPVAPESGAIS
ESELLLKAVLLDSRAVLGPFSGDMMESAASWLDQGTQRVLVNAASSDDADLETVATAVSE
LPASRVVLRIPVALGALVNREEDNVLAASSFALQLQDKIKRLSESASGIVLALQSETSGL
ESAADSEEYALLFKTLVSIRKGLDEGFFFAVEWSALKQENFNREALVPCIAELHHKGIHV
VAPGLSVVTESESAAYVDAGRAFIKCLRSDRPDGLFTTVVADEAGVALGLVYSSEESVLA
AIESGRGVYYSRSRKGLWKKGESSGNFQALVQLDVDCDSDALRFTVEQTGAGFCHLNTRT
CWGEARGLQHLQQMLVSRLQDAPEGSYTKRLFNDPVLLRNKLVEEAQELAEAETISDVAG
EAADVMYFAITRCVAAGATLKDVEKYLDKRALKVKRRPGNSKAYRIEAAAEILKKKD
Download sequence
Identical sequences K3X3I1
PYU1_T011780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]