SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011783 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011783
Domain Number 1 Region: 6-125
Classification Level Classification E-value
Superfamily HRDC-like 1.31e-17
Family RNA polymerase II subunit RBP4 (RpoF) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011783
Sequence length 141
Comment protein Name="PYU1_T011783" Note="Similar to CRCP: DNA-directed RNA polymerase III subunit RPC9 (Homo sapiens)" AED:0.397262081477816 QI:0|-1|0|1|-1|0|1|0|141
Sequence
MKVLMINEGALSDYEVFELMKERKDSRLHKSANVAYAERNWMDHKVLKFLSQTHSKCSQL
DAEKIKNFLREVEKAVIQLTPAEKLQFINHIPVELVDVHLIVEDCAGRFSEAQIEELIQI
VEQTLAVKQDEGDAANTDESA
Download sequence
Identical sequences K3X3I4
PYU1_T011783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]