SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011817 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011817
Domain Number 1 Region: 210-267
Classification Level Classification E-value
Superfamily THUMP domain-like 0.00000000000173
Family Minimal THUMP 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011817
Sequence length 342
Comment protein Name="PYU1_T011817" Note="Similar to THUMPD1: THUMP domain-containing protein 1 (Homo sapiens)" AED:0.0627589381617308 QI:0|0|0.2|0.8|1|1|5|0|342
Sequence
MAGEASGNKRKKQWKSDGQDANKRYKGALSSAASAKGSGGVLVTCDKTKERQSVRDALNI
LNEAADKFFPSTKQEADGGNDEDDEDDDNDASATATTVQQKLQDEINALKSDAKKRKTGR
FTALDTGVKGVILIQILDKEISAIALITKIFEEVEATKEFASRFINRMIPLEKLGHAAKD
DILELAKPMVEAHLKEFQEEQKKLHGDDAEIVPLEYAVEIKRRNCTHLNSMEVINGLAAL
VGPEQKVNLTAPKSIILVEVFRNYHIIVMQSTCGVSVVTKFHEYKKYNVRSILDPPVKGL
VDQRLKFSKKKDEKEADKEQDGDAAKAAAKGDDNDAKKVKAE
Download sequence
Identical sequences K3X3L8
PYU1_T011817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]