SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011899 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T011899
Domain Number - Region: 70-138
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000367
Family Centromere-binding 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011899
Sequence length 157
Comment protein Name="PYU1_T011899" Note="Protein of unknown function" AED:0.0509554140127388 QI:0|-1|0|1|-1|1|1|0|157
Sequence
MSTRVRLTKHQHLLICKKRSECPEWTYNELAEWDRVTFCLTKCPGKSTILDIVKHEAKLS
TLSGDCLSKMRLRSHHMARLDEAVAEFVIEAELSKTPISGREVIRVGAGLANELWIPRRC
RPRFTRSGWLRHFLTRHNFRHKRAHGEIGSVNVEEAL
Download sequence
Identical sequences K3X3V0
PYU1_T011899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]