SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011909 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011909
Domain Number 1 Region: 270-380
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000202
Family Galectin (animal S-lectin) 0.003
Further Details:      
 
Domain Number 2 Region: 462-545
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000255
Family Canonical RBD 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011909
Sequence length 546
Comment protein Name="PYU1_T011909" Note="Similar to 30 kDa ribonucleoprotein, chloroplastic (Nicotiana plumbaginifolia)" AED:0.0650313998760833 QI:0|0.5|0|0.66|1|1|3|0|546
Sequence
MTADVAPAAKDEDATLSDLQQHLQLEACDGKYLTKQESLLLELYQAFATDTGKSVSSMGL
AGSSGNGSLAAEASSLASAGGPPTASMGSSTAIKISSVSTMTKASSAISATATTPKRQLS
SDRERVQNFLLQRQNSGGVASSSAGGATPKGTPVVKPAMSAVERAKLVMAKKVVPAKPAG
ARPGALGAAGSTAVKRTNPLTDILKGGSGSIVGGAPAVKRPRTKSDKPGEIKIQGGRTSI
QLPLESFLRSEDWDSATGPVLDIVLPEVAFATNNTLIIHATMPVRSSRCCFNISTQSSML
SGAPYPGTVLYHFNPRRQRGGHIIQNSNIEGRWGCSQPLPRCPITFGEPFTLRLTIVPSG
FLVFLEEIFQDEFKHRVPIREGENLVLTVPTRDENGNPEGVIVHNVWWGHAEAPANIDLM
RRGPGMGGPGSGGFHHRGGGPRGYDGDRMGPGSGYRGGGGRGGGDRYQGNPHPYEVYVGN
LPQGTSREELSFLFQYLGYETVRITARGFGFVTLRSAEDMHRAVEDLDGKDFNGMKLRVS
CALPPK
Download sequence
Identical sequences K3X3W0
PYU1_T011909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]