SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011932 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011932
Domain Number 1 Region: 322-563
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 2.52e-60
Family MPP-like 0.00046
Further Details:      
 
Domain Number 2 Region: 11-40,104-304
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 2.65e-45
Family MPP-like 0.0000159
Further Details:      
 
Domain Number 3 Region: 807-1003
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 7.94e-34
Family MPP-like 0.0014
Further Details:      
 
Domain Number 4 Region: 564-783
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 1.67e-33
Family MPP-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011932
Sequence length 1050
Comment protein Name="PYU1_T011932" Note="Similar to Nrd1: Nardilysin (Mus musculus)" AED:0.103167546253667 QI:0|0|0|0.75|1|1|4|0|1050
Sequence
MHLVGDVVERSKSPSDQKKYKLLTLPNALQVVLISTKDVTRHGDDNDESDSDEDDEHDDD
KSGDDDDDESEGDERMSSESAGEHSDASEYEEDGEEDRGGHSRRAGACLTVGVGSYAEPE
SLPGLAHYLEHMVFMGSEKYPNENEFESFLSAHGGFSNGSTDNELTNYMFEVGPEHLETA
LDMFAQFFIAPLMKPETMDRELSAIESEFSQATQNDRIRQQQVLCAESKKAHPYAKFGWG
NRKSLKEQPEAEKIDVHKEIRAFYERYYSANIMKLVVCGEDTLEDMEKWVTQSYSKIPNT
NVEVPSFASFGQPFGSQAHPSPVLCRIVPVRDIHTLQLDWMIPPIFGHYRQKPADYIASL
LGHESEGSVLSLLKERGWISALTAGVTETDGNDSGTYGAKFDVTMKLTLEGISHWEEITH
VVFEYLQMLEASDFPEWVFEELKALAEISFRFQEENSAVEKCEELAALMQDMYQVPAHDL
LKVDLFQGAFDKQLVREILPHLSPENVFISLTTKKHGDNPDFQTQALEEEWFGVKYTKED
INDAVVKKWKAVGLNEKLQLPKPNPFIPRDFTLVENGAVDEISCHRFAFGKMWYKPDTMF
ATPRAHIAFLFHLPSVMQSITNVVSTELYVKLVRDALDEYAYHANVAEIMYSLRVKESGL
ELIVGGFNDKLGLLVKVVVEALFHTQVKAARFDIMKQEMLREYRNSISKVAHKAKYLRLQ
LLERVAFPLNQSIAALEATTMESLNAFLANALWNANTHLSSFAHGNISVEAATELRKMVE
ADLERVSSVLPASGIPQRFINQIPPTPSGLLIKARSEHKEEKNTQVEVYYQIGEHNLRTL
AYADLLEQLMEEPLFDTLRTKQELGYDVSCTVRVTHGIVGFGVMVQSSLFDAKYISYCID
RFMIDFEEAIAMMPDEHFHDHVQAQILKKLEPDHNLLETTHRLWYEIASGRLDFDIDDKL
AKEFETCTKPEMLELYHSWILQNPKKLSLHVIGQSSRPAKSVNGKSKEQEMFPVPARIKD
LYAFKMELPFYPDNTRVRDEVESKEERTSL
Download sequence
Identical sequences K3X3Y3
PYU1_T011932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]