SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011942 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011942
Domain Number 1 Region: 372-584
Classification Level Classification E-value
Superfamily Hsp33 domain 3.01e-17
Family Hsp33 domain 0.0045
Further Details:      
 
Domain Number 2 Region: 575-635
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.000000000000209
Family HSP33 redox switch-like 0.0014
Further Details:      
 
Domain Number 3 Region: 19-120
Classification Level Classification E-value
Superfamily POZ domain 0.000000369
Family BTB/POZ domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011942
Sequence length 643
Comment protein Name="PYU1_T011942" Note="Similar to Kiaa1841: Uncharacterized protein KIAA1841 (Mus musculus)" AED:0.124248312613627 QI:0|0.4|0.16|1|1|1|6|0|643
Sequence
MLSPRPRTGAARAAPSGRNVLIHVFDEYRKSTKDFVCDRELLLAKMKYFQAYLNPSNEHD
EIDISVHCDVEIFEWLVKYMQQTEAEWKPRIALENIASILVSSEFLQMDALVEECIRFIT
TRMQAFFQLRVDFGCLSEATITKIADRCTTEDLQKLHDPKGKILSKLQRKKLDAYVKKLQ
DAGRTIERCGDCDILYLKYDAAALCCPKGERQVGVYGELVAQHSPKPDWKIDDFFRDLTS
DKNVTWSQMVGFGHEAKFSCCNTHVFNSDDLAASGCKVKEHIPTYGVQDELGEDAATAQK
SMDAIMKLPGLWDLIRTCDQLARPPKSIANGATSASLSSLRLKIATMDLMQSEFKLQPQM
SWNRQLRDVLFRAHVGNLRIAGVVARNSVKEAARRWELPLSSKATQLWGEYMAGTTMLSS
FYKGEERVKVALRSSAIQDLYVEAMAVGEVRGKVVLADANNLNGIGYDDGHMQVSKILYG
AAKPYETTVRATGIAEADWQTFYDVSEQVPTAVRISSDKMPDSALHGEFYELDDLRFDDV
PLLASSINENNDLLAYLNELIPKADLTEKNCKKIPLDFFCRCSKKGFANRLKELGASELN
HVIQDSAEKGVDLTCHFCNEVYQFPLDELKSIAAELSTTGSSA
Download sequence
Identical sequences K3X3Z3
PYU1_T011942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]