SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012114 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012114
Domain Number 1 Region: 54-147
Classification Level Classification E-value
Superfamily Cyclin-like 0.000000000000177
Family Cyclin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012114
Sequence length 205
Comment protein Name="PYU1_T012114" Note="Similar to CYCU4-1: Cyclin-U4-1 (Arabidopsis thaliana)" AED:0.0280616590018736 QI:0|0|0|1|1|1|2|0|205
Sequence
MIDTKENEERGRMIAHTLAAVVDDIVRESGYEAMPYGQQQQPSKFEAFRAPGISIRDYLM
RIHKYASCSPECFVLALVYIDRLQCMQGFVLTHLNVHRVVITSVVLAAKFFDDHYFNNAY
YAKVGGVLCKEMNELEIEYLLLINFSLHVSTDTYTRFYNELVGHYNRTSSGGRHNPYMSS
SPYYDVEHFVAEDPENEGQLIACRQ
Download sequence
Identical sequences K3X4G5
PYU1_T012114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]