SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012122 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012122
Domain Number 1 Region: 230-543
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.9e-61
Family Histidine biosynthesis enzymes 0.0000000119
Further Details:      
 
Domain Number 2 Region: 4-218
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 3.75e-48
Family Class I glutamine amidotransferases (GAT) 0.0000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012122
Sequence length 547
Comment protein Name="PYU1_T012122" Note="Similar to At4g26900: Imidazole glycerol phosphate synthase hisHF, chloroplastic (Arabidopsis thaliana)" AED:0.0646186440677966 QI:0|1|0|1|1|1|2|0|547
Sequence
MVQVTVLDYGAGNVRSVKNAIRAAGHTFKDAQSANDIRNAEVLVFPGVGHYREAMEFLNA
KGYTDVLREYIQQDKRFLGICLGMQTLFEGSDECPGLKGLGVIKGTVQLFPSDTIAVPHI
GWNGLKVWKKSSLFAHLPQIEEHDATKVYFVHSFRAIKTEKNASWVLTTTNYGDYEFISS
VQKGNVMATQFHPEKSSTIGINILKGFLENIPKVDHDVAIPDAGAQPATKLSKRVIACLD
VRTNDQGDLVVTKGDQYDVRETSDDGAVRNLGKPVDLCTRYYKEGADEVTFLNICSFREQ
PIGDMPMLKVLEASSQQVFVPLTVGGGIREYIDDKQQKFSALDVASRYFRSGADKVSIGS
DAVYAAEAYYARGKKGDGESAIETISGVYGKQAVVVSLDPKRVYVASFYDENAKGHTVVK
LNKPGPNGEEYCWYQATVRGGREARDIDVVQVAQAVEALGAGELLLNLMDMDGQKDGYDL
NLVKLVKDAVTIPVIASSGAGKPEHFTQVFKETNCDAALAAGIFHRKEVSIQEVKDQLHA
DSISVRL
Download sequence
Identical sequences K3X4H3
PYU1_T012122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]