SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012128 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T012128
Domain Number - Region: 24-62
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00201
Family Double-stranded RNA-binding domain (dsRBD) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012128
Sequence length 65
Comment protein Name="PYU1_T012128" Note="Protein of unknown function" AED:0.132395382395382 QI:0|0|0|0.5|0|0|2|0|65
Sequence
MRMWQGMKHTNANEFTTERQANYFRGAKRHHWSFIVGNVEIGSGSHEEKKEAFRLAADDA
MRYPA
Download sequence
Identical sequences K3X4H9
PYU1_T012128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]