SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012138 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012138
Domain Number 1 Region: 368-422
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000502
Family Canonical RBD 0.011
Further Details:      
 
Domain Number 2 Region: 884-928
Classification Level Classification E-value
Superfamily RING/U-box 0.00000906
Family RING finger domain, C3HC4 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012138
Sequence length 933
Comment protein Name="PYU1_T012138" Note="Similar to rngB: RING finger protein B (Dictyostelium discoideum)" AED:0.140792291220557 QI:0|-1|0|1|-1|1|1|0|933
Sequence
MVTAAGAAMEKTPRRRTAPLFGPNDEVAIQNEIRTMIAQTEQLLLGSQRAQPEVQLQQQH
PQSLASTLLPRPPPMEHPSHQRNSSASTRPSRLTLSDIMGNSIQDSEDNGSDLGHHVRSG
LVLADADFEGDGDDEDDDESTEEGSLSTDIGAMFETDELSDGEMDLYASQVNPQRTYQLN
RDLSHEGYGGLNVASIDVEDVGTDDDDATHSERFPSVSNCDVNVSKAQALKDSMQGNLVR
LGFKENLTRLALDAGLQEIEHYDSDCELAYVDIFMSLVKMVCDAHLDSFSHRLPHVAWIN
PDDSWSGVTLANGSDRLPHISSLPFKWPVFDMAQFEFGNARPGTCFDSVCVLTNLPKVSM
DRTEELMEILSCNLFCMIGDPIQVVIPSVSATGRTKGHAFLEFDDPAMAKACASAIDGLT
WGRGPFGRIRSNMFRQYQVKSPTALQMRSEAIRNGESRRSQRTAMNESMGSSTTDANGTG
ARTEYAQFNEEDIETRNTNFFNRWRERFDDSFYTSSEGEGVDEGDDAESEDGGVWAPDAH
PRGEFPSRQPFPQHPISIDDMDIEHLEHHNVMASHPSFGLRHFSSQELGQSRVNESQLSS
DADGDDDDEKEYEDNESWESSSMSELLQADRERVSSDSHARLLNSRSSDLSDVRLPSPRI
GALNHDPSVPNDFVSVGDEDEIVQTADESEKPWRSYCEELIARNREMQEQVAYARRRIMQ
LGHNNQKLHLLIDRVERDRDGLMFENDLLQTQLNGYEDHARHHAALTKELTVLRKCLKKK
VSGLKGSSQDSPFSLHQEIEVKHSMMTNQHASSSSSASLDDVRFVFQQQLSSQALTLKSF
DELKDWEQLLESSLASVRAMKEEKALELQKKLDRQVEEQQELKLCVICLSNEKSILCLPC
RHLCLCESCSAHEEVEKCPICRLHIDEMLLVYA
Download sequence
Identical sequences K3X4I9
PYU1_T012138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]