SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012145 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012145
Domain Number 1 Region: 19-98
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000466
Family Tetracyclin repressor-like, N-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012145
Sequence length 98
Comment protein Name="PYU1_T012145" Note="Similar to tc3a: Transposable element Tc3 transposase (Caenorhabditis elegans)" AED:0.108 QI:0|-1|0|1|-1|0|1|0|98
Sequence
MSKGGRLSGQEQGFILGKRDEGKSIGAIAKELQCSPSTAHNSLKDPEQYRTRKRPGRPRK
LTDRGVRQVNKTAKQRGMSASRIKSTLNLFVSKRTVQR
Download sequence
Identical sequences K3X4J6
PYU1_T012145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]