SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012165 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012165
Domain Number 1 Region: 693-777
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000618
Family Smg-4/UPF3 0.09
Further Details:      
 
Weak hits

Sequence:  PYU1_T012165
Domain Number - Region: 329-398
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0115
Family Canonical RBD 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012165
Sequence length 958
Comment protein Name="PYU1_T012165" Note="Similar to mei2: Meiosis protein mei2 (Schizosaccharomyces pombe)" AED:0.199165797705944 QI:0|0|0|0.25|1|0.75|4|0|958
Sequence
MITTTASAPLRDEKPEGVSHRLHPDALSLKAAMIRDGEATDTLVDPDQEIAPGSPIILKD
NEAESYDLWSNWSVRSFSERSSSIDSTSQWRNLRSLSIDSKASSATNAGDDDLPLQSISK
SLQSLAFASPQEEKHMVAEPPSSNLFASRPRSFSDYSSLRSSSSSHSRHSSMGDKNLWHE
SSAKIGSESARHAMTSPLYPTSCMELWQAMKTNFPSRHLILKNAKGTFDTTDVTRIRDNM
NNFGSLAKVRSEFASEGLLFFTFFELKCAIGAAKHWQSSNFASVAEPSPQRQPSPAFSPP
VSSIRSSFPNYTGETIHFCLPYELPDDVNCATLLVQLHGPPMSSNEMRQFSSRYGEVASV
LQNDINSSKYIVEYNDARDIDEAIRGLTSSFHASGPITAARTSPPTLDMAKIQLFQERLD
TLSVLVAPHLMDLETRARTSFSSSTASLLTSSPTSTPSSPLNGSLLETSADGNGIELSLD
VATASRTTSPFDGGLYQIRKSSPSIVNSEDSTIWSGRAAASSSLRPRSSSSSLISIGSSG
SSMTSAAAPNMFADPGHYSNPYNPGMTSSAIESSATVPSYAPSHHLQQQQQHGLHLAPAQ
HPTGAQFHHQHLQQRIMLASGGMMANKYGGPARSGSDPSFRSSNSGSSSAHFGGSFASNS
SNGTVTTGRNDQGVGEFSLSIERVSAGEDTRTTLMIRNIPNKYTQQMLLHEINVHHRGQY
DFFYLPIDFKNKCNMGYAFINFMDAASIVPFYQEFDSQKWTNFNSEKVCAISYARLQGKQ
AMITRFQNSSLLEKHESYRPLVFVSSGMNRGKPEPFPASKQQPSHKKQLHHSHHPHHHMM
MTMMGGAGDDFNSAAGRMYTMQTHLQQQQQLQALQHAQYQLMANSHHHMNFSNGMPLASQ
NSGNLNFHHQQQHGFHAPMQHQHQQEQRHAKTTRPLAFGASSSAANNSTAAPTPGYST
Download sequence
Identical sequences K3X4L6
PYU1_T012165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]