SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012248 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T012248
Domain Number - Region: 47-87
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0998
Family Leucine zipper domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012248
Sequence length 367
Comment protein Name="PYU1_T012248" Note="Protein of unknown function" AED:0.130434782608696 QI:0|-1|0|1|-1|1|1|0|367
Sequence
MSHSEYAAPAIPASLSPASAAALVIASRAPPLLPERRSSLGDGRRGRARAKSNSERARQF
RQREKAHEDSLHREIHQLHQHIARLSLLKSVYAQKALVTRTSRCGSLEKLTVELYQAHRH
GLETIDDADRTALTMSKSTAARYQSVQLKESFLHKMFDPDVRRGDLVGVDAIINQWRKHT
SSYAKFDMEISHVEPITGSQEHPIIVIHTKMHVRFARETFSIMFPFAAGRRDDLVERVVG
KDITLSCVSRFQFSEADQVTSYTVEIGFVDAFLKLLGDVNDVVELMKLSVISPGARLVDN
ATPERHRKRNRNRNDASEEERKAVFSDIPPHSYPIATPSLPSAKLSVQYLLTDELQARLS
KNVPLDG
Download sequence
Identical sequences K3X4U9
PYU1_T012248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]