SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012287 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012287
Domain Number 1 Region: 43-137
Classification Level Classification E-value
Superfamily Homeodomain-like 1.22e-28
Family Myb/SANT domain 0.0034
Further Details:      
 
Domain Number 2 Region: 1-40
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000136
Family Myb/SANT domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012287
Sequence length 270
Comment protein Name="PYU1_T012287" Note="Similar to MYBL1: Myb-related protein A (Homo sapiens)" AED:0.011070110701107 QI:0|0|0|1|1|0.5|2|0|270
Sequence
MLRQGVYQHGSKNWRQISSCVEDKSSTECCQRWRELQNFETVQRQRWGPAEDAKILELVT
RYGTRRWTIVASYIPGRTAKQCRERWYYQLDPEINKAPWTLEEEEILVAMHTEFGNSWTK
IAEKLPGRTDNAVKNHFSCMKRKLEQQPEVDGKRRATISDHGIQGSDATRDGIRAPYNNF
SMKLCDGVESRASVEDIDSETKFNELMLEPATLEERDSLPSQHAHDKGDGDGLLAPTLFT
KFVDKVYESVQNELRASSLTDEEIKARGCE
Download sequence
Identical sequences K3X4Y8
PYU1_T012287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]