SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012289 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T012289
Domain Number - Region: 136-185
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000152
Family Centromere-binding 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012289
Sequence length 190
Comment protein Name="PYU1_T012289" Note="Similar to tnpR: Transposon Tn21 resolvase (Escherichia coli)" AED:0.0916230366492147 QI:0|-1|0|1|-1|1|1|0|190
Sequence
MAAMTVLPSFQTFLQSTTRPLSPLSTTQFPSSATSAPSPLDQQDRFTPPFPAATLSPSLW
KAASFASSRSSFSSFSSSDEDDGEYEYAHSDQFRLQHERARAENFVVRRRAGHSFASTVG
LPSSPLSLEATAKRAKKKYLKERERCEIVRRVRAGEKQAHLAKEFGVSRAAVCYLLKHQM
EILRRSAQRL
Download sequence
Identical sequences K3X4Z0
PYU1_T012289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]