SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012300 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012300
Domain Number 1 Region: 285-403
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-19
Family Pleckstrin-homology domain (PH domain) 0.0053
Further Details:      
 
Weak hits

Sequence:  PYU1_T012300
Domain Number - Region: 777-829
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0002
Family Synaptotagmin-like (S variant) 0.065
Further Details:      
 
Domain Number - Region: 440-501
Classification Level Classification E-value
Superfamily NTF2-like 0.0329
Family SAV4671-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012300
Sequence length 873
Comment protein Name="PYU1_T012300" Note="Protein of unknown function" AED:0.246733339416827 QI:0|0.5|0|1|0.5|0.33|3|0|873
Sequence
MSITRREANVTLNRRESNLTLDGEEECVVEIERIETPWMSRELFHTLWQNATLQIGSSCS
FTKYAKKVTTTAATTGGSREESEGSLRKANDTILENGQQQIQSDEQDEQHRADFRSQLLK
AIGDDIVVFPQRGESPTVRRSSSATSKESFPLTPRAKGSDATRRRVFVIYGYAGISDNYG
LRTVLLIRLEQLHGSEQIAISIKNTDPLERTRMNAFMSILQQRIQPGVPPRRPHARIGDT
STLFLEEISDEDGDASAAGSSSKQARKSELVGTPPPVAPIVVNPSRDLTTVQATRSRSHT
VRYRNGDGISFEGYLNKKSDLLQSWKALYCVLEGETMAYYESREDFIMNTKLIGRIHIQS
VEDDHMGKPNGFRILTEGHRTNHLSSRTAFEKDQWKRAITAAITKAPEAARPHVAFGSQP
LDAPKFYRLLGALLRQELSDFPLLFQSIHPDVVVTSNFPPIVPFWGQYRRYDGVLLFIST
LLESVEVESFTMVEVMELVRGDADCVDGFSDHETIENGFAASPAELNGNYTVSPRGSSQS
GPLSAFTPSTWEKRLVVTGKETYCLINHDSRRITQLFVHELWLDHKDRLVRWHMNGDSVA
LSVAFDDAARGENIRLVLPGEASAISQSIPPGTFYVQILRALQLHPVEQINGKNGSTQHL
NSSQHGKGSGAASSSSKKVYPVYVRCILEEGTHMERTLDGLDLHSSGIRADELSKSHPVA
LSEKRRPSSGTRLFRGFKRAAGISGERTFAPFGDRSGCVTNMCKCSLEVDPGSDSIGTLN
PQWASNLRLEFPGCARGFTYFLKLEVFQSRFMLADEIIGVCKINLTPYLSLFSGSADAKA
NGALPRWHNFSYGLTDLQVAGTWVSQVIQPVDL
Download sequence
Identical sequences K3X501
PYU1_T012300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]