SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012321 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012321
Domain Number 1 Region: 172-296
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.12e-25
Family Synaptotagmin-like (S variant) 0.0085
Further Details:      
 
Domain Number 2 Region: 2-137
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.55e-22
Family Synaptotagmin-like (S variant) 0.013
Further Details:      
 
Domain Number 3 Region: 372-477
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.55e-20
Family Synaptotagmin-like (S variant) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012321
Sequence length 483
Comment protein Name="PYU1_T012321" Note="Similar to MCTP1: Multiple C2 and transmembrane domain-containing protein 1 (Homo sapiens)" AED:0.645115022597705 QI:0|0|0|0.5|1|1|4|0|483
Sequence
MSKGAVYVTIAEARGILAADSNGFSDPYVVMTVLDSKGNAIAAGGSFKTKVIKKTLTPRW
NEEYLVGDKSDLRLATTLRLALFDDDAFAMNDDPLGVVDIPVALFLGVTQTLDNWYQLTR
AQKMKKDATGELHVIIRPADPPVGVEATSFAAGLGASVKGAMDAAVGASDGPPNLLFVTL
KSGKDLLGMDNNGTTSDPLVKLSLAGQKHESTKKEKTLRPQWNEKFGFFITDLKSTLSII
VEDFDVTINDFMGSANVSISDLQPNVEKNMTVELGDKRGKKDKKERGTLQISLLWTYRAD
ARDIAAKKKDTTFLGTIKGALNVGNPDAGYDSNDEDGIEIDDKASKKSDEELKKEEEERE
KKREEMLKELSSIEIKSGDYMIQVHVIEARDLVPKDSTGTSDPVVYVEVLSEKQQTATKK
QVLNCVWDDLLIFPMRNLDKSEVEMGYVKLSVMDANTLQRAELIGGAQFDLSRTINSRMC
GLV
Download sequence
Identical sequences K3X522
PYU1_T012321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]