SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012322 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012322
Domain Number 1 Region: 249-385
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.42e-24
Family Synaptotagmin-like (S variant) 0.034
Further Details:      
 
Domain Number 2 Region: 684-789
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000283
Family Synaptotagmin-like (S variant) 0.068
Further Details:      
 
Domain Number 3 Region: 824-955
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000139
Family Synaptotagmin-like (S variant) 0.017
Further Details:      
 
Weak hits

Sequence:  PYU1_T012322
Domain Number - Region: 405-516
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00142
Family Synaptotagmin-like (S variant) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012322
Sequence length 1112
Comment protein Name="PYU1_T012322" Note="Similar to Myof: Myoferlin (Mus musculus)" AED:0.155416372073073 QI:0|-1|0|1|-1|1|1|0|1112
Sequence
MVKALGGKIPPFWTNIYGAPLKHNKVELGDSMKKQMNNLPEIATTYRGRMLMTLEMLDND
ADEFDEVNQKRNVKKLPRDLYPRTRIYKMRAHFVLGCEIPAFLSPKNLGKNSKMQLVMTC
GLNEIRSSRRPNLKGVVEWNDMEEGEKMLLPEDLSQVPDIFLYLCKGEGDNRKPVCYRRF
TAKELVGDHGGFTNDVQWISMKEDSSIDALADDEFPGNVLVRLGFGTEEDAHRTPWDRAD
MDAVNKRVPYQLRVHVYQGRRLPPADSNGLLDPYLVVRCLGEKPKETSKKKKTRDPLWYE
TIYFDINLPELKYAPQVMLRVMDYDEFDSNDFVGLAALNLSDAHIRTSQQLADGKLSTLP
DPKWYPVMYQEPGDSEGELLASLELIRKQFPDENIPPSVSIVPETRKAFLEITVLGLRSM
EPFQFLPIQLPFIEFILGGKDHASQEMITEKSKRPTGSNPNYLQRILKEVELPVNAHFAP
RLNIIVKDTRLGGFQTPIIGSASIEMSSKIPWSKHYRPPQSDNFAEIELETADEFSEESP
LLGGGDKDDVESVDNGAGVFGALKSMGVDFDAAGGFDDAASRHSSNPEDDEDEKQKKYLK
HRDLLDSELESELKTTPFEKYALHIGQKQKKRSMLAMLNPFKKKPASVGGDGLYKIAGQF
KGLIRIIEREDERPLLDMERLMKSLPYEIRIYVLDGVGFAPMDLGLNGRPGKSDPYLRMK
LGKEKVDDRKNFIDDTTDPDFYKMYQINALLPGASILTIEAMDHDFVGGDDLIGRTTIDL
EDRLFDQRWQDMGKMYETSSRLRPKPLETRTLNIPTSKAPMGTIKMWIDILTPNQAHEYP
PIDISLPPPVDLELRVIIWKARNVPSFDEAEDMNDLFFRCWMEGSDYQETDIHWRAKKGK
GSFNWRMKFPITLGHKQPNTKTPYFHIQGWDKDVFTANDAIGESMMDLGTYFQRAYKQKT
NVQFFEDDEETRKKKKKATSDDDAAVKKIKEATGLWDDDDPPDAKWIKLESVDHKTHTRN
YMGEVCVSMEVVPMEKAKQQPVGQGRSAPNNSPYLPPPAGRLSFSLNPFKVFNDLLGPSI
CNRIMCCLCCVAFMVLIYFLAPFINLAIVTFK
Download sequence
Identical sequences K3X523
PYU1_T012322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]