SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012324 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012324
Domain Number 1 Region: 84-248,301-431
Classification Level Classification E-value
Superfamily DNase I-like 2.04e-56
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012324
Sequence length 466
Comment protein Name="PYU1_T012324" Note="Similar to INPP5E: 72 kDa inositol polyphosphate 5-phosphatase (Pan troglodytes)" AED:0.193790149892934 QI:0|-1|0|1|-1|1|1|0|466
Sequence
MKKNRRASITAFFKGDDAIEMHAAAPEFPEKSGNDEDGRKLSRGGRNNSEGNVAEWPVEF
NLEGLDDWEELNSISNANGDCVTHTHFLSKSKLRVFCGTWNMHAKKPQDDLRLWIPLNKY
HIVAVGTEECVNSIAKSVVFTSKKQWEDLLKETLGEEYVLVSSHSLTAIHNIVFVHESVI
PLLSNIQSDAVATGLGNQLGNKGGVGIAFSIGRTSFAFVNCHFDAHQQNTEKRNGNFHRI
NQELKLYPSQNPLITPGSSSSPPSNAVTGLASLDGLGKTTATRFSTVSSNSPPVGLLGKK
QAISECFDRVFWFGDLNYRINGTRRMVDLLLLHNKYEVLRFNDQLQIEMTKGHVFSHFQE
GPLHFRPTYKFDKHSNVYDSSSKQRIPSWTDRVLYLSNEKANDIEILSYRSQMSFQTSDH
RPVGATFQVNFKWRFGATEDNSTEFSRVLARGYRANQAKSEVCTVQ
Download sequence
Identical sequences K3X525
PYU1_T012324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]