SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012353 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012353
Domain Number 1 Region: 50-144
Classification Level Classification E-value
Superfamily Homeodomain-like 8.44e-31
Family Myb/SANT domain 0.0013
Further Details:      
 
Domain Number 2 Region: 5-42
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000104
Family Myb/SANT domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012353
Sequence length 462
Comment protein Name="PYU1_T012353" Note="Similar to myb: Myb protein (Xenopus laevis)" AED:0.3207343412527 QI:0|-1|0|1|-1|1|1|0|462
Sequence
MLNTQDDTLRAAVYKHGGKKWRTIALALPSHTASQCNARWNELQNVGTAVKKPWSAAEDA
RMVELVRSHGPGRWAVIASYLPGRNGKQCRERWHNQLNPDIKKDSWSPDEDRLIVELQTK
YGNAWAKIADQLPGRTDNAVKNRWHSSLLKVDSFKATSSCSTSSKKKSHKKASPRPGKKR
KVVSVRVADDANASSRAAIEGDPQKGQSSPTGIDANLRELYGELLSAAAHAPLSVQANQE
SAEPASFEGLVHLVSVCAADSLLEEPAAHSAATSNCSSNHDVFEIPTLDTCFSAMMNPFA
MTMMDAPEGLADDASGLDALSQSHLPNSYTLHFDDLGSSSSLFFKDDCMIDPTQYMAAAM
QPVKCSPSNLQTEDDLALFESIWKGDVAGESSSSNPMTASNSSVLFGEVLEPTSSSDASP
NFVGHDVPLEPPCVIRAEHDEVGSAAALPAAPGSSYCEDILL
Download sequence
Identical sequences K3X554
PYU1_T012353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]