SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012413 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012413
Domain Number 1 Region: 404-604,647-731
Classification Level Classification E-value
Superfamily PP2C-like 8.89e-72
Family PP2C-like 0.0000217
Further Details:      
 
Domain Number 2 Region: 314-408
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.4e-17
Family FHA domain 0.0026
Further Details:      
 
Domain Number 3 Region: 199-304
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000363
Family FHA domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012413
Sequence length 737
Comment protein Name="PYU1_T012413" Note="Similar to Os05g0587100: Probable protein phosphatase 2C 52 (Oryza sativa subsp. japonica)" AED:0.0858971896805583 QI:0|0.25|0.2|0.4|1|1|5|0|737
Sequence
MSENPGEQVQTLKMNDGAQYGGVLRKYENEIEHHRRRSTTVLLDPPSSSESGKVLSFGRA
RNSGVNRLLRSSTSSTSSYHSCADTSRSNSSVLENSSDDAGFTTAAAISSQNGDSNKPQH
TLNSAPASPHHKQQGNGYSHDLDKHDDTKQKPSAAAHDNTKSQQPPDFDNLLIPSSVEPY
IVSEYQGHTFPEHVWTHVVLKMTAFSDDDVVTSFRFGVEGGSIGRDAGVNTASIPADKLL
KHEAHARILYAHGGFYLQNCDESSSGTFVRLGPCSDLDEDDDGRMQWPLDPNVVFRVGKS
DFLVTKYNEGEQTMELTVLSGKLQGTVFTIGTSGAGIGRSADNEIHASDGELSRKHAAIW
FDELTHKFYLIDLNSTNGTFMKLVGPYHEPYRLEIGDDLLISQTCLTVNRFDFGVHASMG
QRKTMEDAHTIIQDLNIESLSCLGLHPQSYFAVYDGHGGAEASSFLGDTLHHNIIDEFRF
KKKQFDPLLKLPQDEIHAMVRQRLISAFEKTDDEFMHESERPQAGSTATTVLIAGKYLFV
ANTGDSRTVLSRKRVAVRLSNDHKPSRADEAQRIRDTGGFVIHGRIMGELAVSRAFGDSP
FKTFELPEPPKEEANEASGNSGNGSGSKKPHSSEYDSQELPVNPNEILKGPLVIATPEVT
TTEITDDDEFLLLASDGLFDVLKDQDAVNYLRQKLVELNDVQRAVEALVEYAIFQQRSTD
NVTAVVILFKEPRELSK
Download sequence
Identical sequences K3X5B4
PYU1_T012413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]