SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012419 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012419
Domain Number 1 Region: 37-242
Classification Level Classification E-value
Superfamily Ribosomal protein L1 1.83e-34
Family Ribosomal protein L1 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012419
Sequence length 380
Comment protein Name="PYU1_T012419" Note="Similar to RSL1D1: Ribosomal L1 domain-containing protein 1 (Bos taurus)" AED:0.162536035454585 QI:0|0|0|0.5|1|1|2|0|380
Sequence
MDVKKGLRNPLEEAQVRKAVIALQAFVDKQKAALPKKPLVDSVEYVSAIITRKLIPTKGS
HKPIQIAIPHSLRGGDNDAEMCLIVKNGDKDRIKAALAADPVAGLAKVMDIKKLKKNFSR
FEDRRTLAGAYDLFLADDRIVPYLPEALGSKFFIKKKQPVAVRVSRKDVSNGIRAIYQRT
QMVVSTGVCSNVKVAHLGMNVDEAVENILVAMNNCAAHIPKGWNGVQSISIKTHDSVALP
IYNALSTLAKLPPMSKTHALQKRKLEEAESSDAVKETAKPAKKAKKEDAAKKEEAPKKDA
KKAKKEAPVKKEATPTKNAASKKEQKKKDKTATPVKAETTDNSSNVSKKRKTDEPAAKKK
SAGAKSTPPQKKSTKPSKKK
Download sequence
Identical sequences K3X5C0
PYU1_T012419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]