SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012420 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012420
Domain Number 1 Region: 18-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000138
Family Ubiquitin-related 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012420
Sequence length 305
Comment protein Name="PYU1_T012420" Note="Similar to gpsn2: Trans-2,3-enoyl-CoA reductase (Dictyostelium discoideum)" AED:0.0272331154684096 QI:0|1|0|1|1|1|2|0|305
Sequence
MVLSVNVVKPGKKVRDFGAVEVDDKATVAQFKAAFEKKTKISRHRQNFKLQDATGALVSL
ADDSKTLASYGVKSNGQLQFKDLGPQIGYRTVFIAEYLGPLLFVLFYATRPAFLYGKDAA
SKPFDHTAWLGVAAWSAHFLKREFETLFVHRFSRPTMPLFNLFKNCSYYWSFGAVVGYPL
AHPDYKGPTSELQIQIGLALFAVSELLNFLVHVQLRNLRPAEGSKVRPVPKGPLFALVSC
PNYTFEVLGWVGFSLFTQIFFSYLFTLVGFLQMTDWALKKHRGYIKSDGDAYKKLRRKAI
VPFVI
Download sequence
Identical sequences K3X5C1
PYU1_T012420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]