SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012460 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012460
Domain Number 1 Region: 283-404
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-21
Family UBX domain 0.01
Further Details:      
 
Domain Number 2 Region: 88-228
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000962
Family UAS domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012460
Sequence length 406
Comment protein Name="PYU1_T012460" Note="Similar to Faf2: FAS-associated factor 2 (Rattus norvegicus)" AED:0.0753664111873067 QI:0|0.33|0.25|0.75|1|1|4|0|406
Sequence
MPDAAPPPHENRDAPDEATGLRRRPVAAADASLASSESATASSSASPSSSRAAATSQRRR
KGFVELLFSPLSFVLGDGEPEDPQVSARAFTHALRRRYGDVFPRFEHTSFRDAVSTARTA
SKFLLVFLHSNIHDDADAFCRDALCTEQLSTYLNDSDCIVSWAGCVQHAEGFGVSLSLGC
ATFPFLALLTCVSRGVNVVEKITTNLPADQIIRRLESAVDRNTQILATARRQHQQRSEAQ
LLREQQDREYQESLAADRQREEEARLQEQRLIEEQLRAEQEAREKEEEERRQAEAFQQTM
DAKRARLADAPPSRVPPPGADYKTAVLKFHLHNGTRLERVFYAHDTLQTVRDFIDVQFFD
REIKITNYELATNFPKKTYGPDLLDLTLQEVGLAPQALVFVQDLDS
Download sequence
Identical sequences K3X5G1
PYU1_T012460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]