SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012475 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T012475
Domain Number - Region: 125-228
Classification Level Classification E-value
Superfamily Bet v1-like 0.00162
Family AHSA1 domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012475
Sequence length 299
Comment protein Name="PYU1_T012475" Note="Protein of unknown function" AED:0.119289340101523 QI:0|-1|0|1|-1|1|1|0|299
Sequence
MEYCHDHIHKIQKKLSGSEIKIHKAVKKFMELPNVYGNAYGFMDAILREKYSCGEYHLSV
LIEFFRELPEPEHKLDGCLVLLQVDAQMLTSNHRHHSLALAYFIYELMATLDHTPSKPRV
DQMWFEWYAPAVHEIVYGHAVQIESITRNERLYLPADDIKYDSERRFALTWTQPWAASRE
NVEAQWQLRPGNDDKTWFYLVNVKYHDEYIYTSETHHDHCHHGSHFAFSRSGGNPEDKGR
WELHSFSRDVFALYNRQYGVYLYASDLLRDPERRFALTARPDAPLYENHKWLLRPLPEF
Download sequence
Identical sequences K3X5H6
PYU1_T012475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]